![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein automated matches [190198] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries) |
![]() | Domain d2x0vb_: 2x0v B: [207088] automated match to d2ahia_ complexed with x0v, zn; mutant |
PDB Entry: 2x0v (more details), 1.8 Å
SCOPe Domain Sequences for d2x0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0vb_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv cacpgrdrrteeenl
Timeline for d2x0vb_: