| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species) |
| Species Amycolatopsis orientalis [TaxId:31958] [158904] (3 PDB entries) Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899 |
| Domain d2x05b5: 2x05 B:778-899 [207073] Other proteins in same PDB: d2x05a1, d2x05a3, d2x05b1, d2x05b3 automated match to d2vzsa2 complexed with cd, x05 |
PDB Entry: 2x05 (more details), 2.3 Å
SCOPe Domain Sequences for d2x05b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x05b5 b.1.4.1 (B:778-899) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]}
gsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvd
skvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvp
ad
Timeline for d2x05b5: