Lineage for d2x05a4 (2x05 A:675-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762908Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species)
  7. 2762909Species Amycolatopsis orientalis [TaxId:31958] [158904] (3 PDB entries)
    Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899
  8. 2762917Domain d2x05a4: 2x05 A:675-777 [207067]
    Other proteins in same PDB: d2x05a1, d2x05a3, d2x05b1, d2x05b3
    automated match to d2vzsa3
    complexed with cd, x05

Details for d2x05a4

PDB Entry: 2x05 (more details), 2.3 Å

PDB Description: inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine-configured castanospermine and an amino-australine analogue
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2x05a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x05a4 b.1.4.1 (A:675-777) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]}
plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav
tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg

SCOPe Domain Coordinates for d2x05a4:

Click to download the PDB-style file with coordinates for d2x05a4.
(The format of our PDB-style files is described here.)

Timeline for d2x05a4: