Lineage for d2x05a3 (2x05 A:336-674)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340155Protein Exochitosanase CsxA [159383] (1 species)
  7. 1340156Species Amycolatopsis orientalis [TaxId:31958] [159384] (3 PDB entries)
    Uniprot Q56F26 336-674
  8. 1340159Domain d2x05a3: 2x05 A:336-674 [207066]
    Other proteins in same PDB: d2x05a1, d2x05a2, d2x05a4, d2x05a5, d2x05b1, d2x05b2, d2x05b4, d2x05b5
    automated match to d2vzsa5
    complexed with cd, x05

Details for d2x05a3

PDB Entry: 2x05 (more details), 2.3 Å

PDB Description: inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine-configured castanospermine and an amino-australine analogue
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2x05a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x05a3 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]}
dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg
hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl
rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp
ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy
hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp
stgliywmlnspwtslhwqlfdaymdqngayygakkane

SCOPe Domain Coordinates for d2x05a3:

Click to download the PDB-style file with coordinates for d2x05a3.
(The format of our PDB-style files is described here.)

Timeline for d2x05a3: