![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Exochitosanase CsxA [159383] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [159384] (3 PDB entries) Uniprot Q56F26 336-674 |
![]() | Domain d2x05a3: 2x05 A:336-674 [207066] Other proteins in same PDB: d2x05a1, d2x05a2, d2x05a4, d2x05a5, d2x05b1, d2x05b2, d2x05b4, d2x05b5 automated match to d2vzsa5 complexed with cd, x05 |
PDB Entry: 2x05 (more details), 2.3 Å
SCOPe Domain Sequences for d2x05a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x05a3 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp stgliywmlnspwtslhwqlfdaymdqngayygakkane
Timeline for d2x05a3: