Lineage for d2x05a1 (2x05 A:48-225)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2384159Protein Exochitosanase CsxA [158961] (1 species)
  7. 2384160Species Amycolatopsis orientalis [TaxId:31958] [158962] (3 PDB entries)
    Uniprot Q56F26 42-225
  8. 2384161Domain d2x05a1: 2x05 A:48-225 [207064]
    Other proteins in same PDB: d2x05a2, d2x05a3, d2x05a4, d2x05a5, d2x05b2, d2x05b3, d2x05b4, d2x05b5
    automated match to d2vzsa4
    complexed with cd, x05

Details for d2x05a1

PDB Entry: 2x05 (more details), 2.3 Å

PDB Description: inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine-configured castanospermine and an amino-australine analogue
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2x05a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x05a1 b.18.1.5 (A:48-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]}
agnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfyst
nmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngayt
rhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg

SCOPe Domain Coordinates for d2x05a1:

Click to download the PDB-style file with coordinates for d2x05a1.
(The format of our PDB-style files is described here.)

Timeline for d2x05a1: