| Class b: All beta proteins [48724] (174 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein Exochitosanase CsxA [158961] (1 species) |
| Species Amycolatopsis orientalis [TaxId:31958] [158962] (3 PDB entries) Uniprot Q56F26 42-225 |
| Domain d2x05a1: 2x05 A:48-225 [207064] Other proteins in same PDB: d2x05a2, d2x05a3, d2x05a4, d2x05a5, d2x05b2, d2x05b3, d2x05b4, d2x05b5 automated match to d2vzsa4 complexed with cd, x05 |
PDB Entry: 2x05 (more details), 2.3 Å
SCOPe Domain Sequences for d2x05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x05a1 b.18.1.5 (A:48-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]}
agnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfyst
nmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngayt
rhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg
Timeline for d2x05a1: