Class a: All alpha proteins [46456] (289 folds) |
Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) duplication: all chain but the N-terminal helix forms two structural repeats |
Family a.124.1.1: Phospholipase C [48538] (3 proteins) |
Protein automated matches [227024] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [225788] (1 PDB entry) |
Domain d2wxua1: 2wxu A:1-249 [207060] Other proteins in same PDB: d2wxua2 automated match to d1gyga1 complexed with ca, cd, zn; mutant |
PDB Entry: 2wxu (more details), 1.8 Å
SCOPe Domain Sequences for d2wxua1:
Sequence, based on SEQRES records: (download)
>d2wxua1 a.124.1.1 (A:1-249) automated matches {Clostridium perfringens [TaxId: 1502]} wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn aydlyqdhfwdpdidnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl hdvsegndp
>d2wxua1 a.124.1.1 (A:1-249) automated matches {Clostridium perfringens [TaxId: 1502]} wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn aydlyqdhfwdpdiwylaysipdtgesqirkfsalaryewqrgnykqatfylgeamhyfg didtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdilknkdfnaws keyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrflhdvsegndp
Timeline for d2wxua1: