Lineage for d2wxta1 (2wxt A:1-249)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009738Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2009739Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2009740Family a.124.1.1: Phospholipase C [48538] (3 protein domains)
  6. 2009741Protein Alpha-toxin, N-terminal domain [48541] (2 species)
  7. 2009747Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries)
  8. 2009748Domain d2wxta1: 2wxt A:1-249 [207058]
    Other proteins in same PDB: d2wxta2
    automated match to d1qmda1
    complexed with ca, cd, zn

Details for d2wxta1

PDB Entry: 2wxt (more details), 2 Å

PDB Description: clostridium perfringens alpha-toxin strain nctc8237
PDB Compounds: (A:) phospholipase c

SCOPe Domain Sequences for d2wxta1:

Sequence, based on SEQRES records: (download)

>d2wxta1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

Sequence, based on observed residues (ATOM records): (download)

>d2wxta1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdlaysipdtgesqirkfsalaryewqrgnykqatfylgeamhyfgd
idtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdilknkdfnawsk
eyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrflhdvsegndp

SCOPe Domain Coordinates for d2wxta1:

Click to download the PDB-style file with coordinates for d2wxta1.
(The format of our PDB-style files is described here.)

Timeline for d2wxta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wxta2