Lineage for d2wwmd1 (2wwm D:1-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755322Domain d2wwmd1: 2wwm D:1-99 [207054]
    Other proteins in same PDB: d2wwmd2, d2wwmt2
    automated match to d2y9rt_

Details for d2wwmd1

PDB Entry: 2wwm (more details), 2.3 Å

PDB Description: crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
PDB Compounds: (D:) titin

SCOPe Domain Sequences for d2wwmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwmd1 b.1.1.0 (D:1-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirsi

SCOPe Domain Coordinates for d2wwmd1:

Click to download the PDB-style file with coordinates for d2wwmd1.
(The format of our PDB-style files is described here.)

Timeline for d2wwmd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wwmd2