SCOPe 2.07: Domain d2wwkt1: 2wwk T:1-98

Lineage for d2wwkt1 (2wwk T:1-98)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2wwkt1: 2wwk T:1-98 [207053]
   Other proteins in same PDB: d2wwkt2
   automated match to d2y9rt_
   complexed with gol, so4; mutant

Details for d2wwkt1

PDB Entry: 2wwk, 1.7 Å

PDB Description: crystal structure of the titin m10-obscurin like 1 ig f17r mutant complex

PDB Compounds: (T:) titin

SCOPe Domain Sequences for d2wwkt1:

Sequence; same for both SEQRES and ATOM records:

>d2wwkt1 b.1.1.0 (T:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirs

Timeline for d2wwkt1:

• d2wwkt1 first appeared in SCOPe 2.03, called d2wwkt_
  
• d2wwkt1 appears in SCOPe 2.06
  
• d2wwkt1 appears in the current release, SCOPe 2.08