Lineage for d2wwkt_ (2wwk T:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519303Domain d2wwkt_: 2wwk T: [207053]
    automated match to d2y9rt_
    complexed with gol, so4; mutant

Details for d2wwkt_

PDB Entry: 2wwk (more details), 1.7 Å

PDB Description: crystal structure of the titin m10-obscurin like 1 ig f17r mutant complex
PDB Compounds: (T:) titin

SCOPe Domain Sequences for d2wwkt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwkt_ b.1.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
dlttliimdvqkqdgglytlslgnefgsdsatvnihirs

SCOPe Domain Coordinates for d2wwkt_:

Click to download the PDB-style file with coordinates for d2wwkt_.
(The format of our PDB-style files is described here.)

Timeline for d2wwkt_: