SCOPe 2.06: Domain d2wwhb_: 2wwh B:

Lineage for d2wwhb_ (2wwh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)

8. Domain d2wwhb_: 2wwh B: [207048]
   Other proteins in same PDB: d2wwha2
   automated match to d3tmke_
   complexed with na, t5a

Details for d2wwhb_

PDB Entry: 2wwh, 2.7 Å

PDB Description: plasmodium falciparum thymidylate kinase in complex with ap5dt

PDB Compounds: (B:) thymidilate kinase, putative

SCOPe Domain Sequences for d2wwhb_:

Sequence; same for both SEQRES and ATOM records:

>d2wwhb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylk
mensmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcm
npdqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinida
trkiedihndivkevtkikvepeefnflws

Timeline for d2wwhb_:

• d2wwhb_ first appeared in SCOPe 2.03
  
• d2wwhb_ appears in SCOPe 2.05
  
• d2wwhb_ appears in SCOPe 2.07
  
• d2wwhb_ appears in the current release, SCOPe 2.08