Lineage for d2wwgb_ (2wwg B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366487Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)
  8. 1366500Domain d2wwgb_: 2wwg B: [207045]
    automated match to d3tmke_
    complexed with adp, dgp, gol, na

Details for d2wwgb_

PDB Entry: 2wwg (more details), 2.4 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with dGMP and ADP
PDB Compounds: (B:) thymidilate kinase, putative

SCOPe Domain Sequences for d2wwgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwgb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylk
mensmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcm
npdqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinida
trkiedihndivkevtkikvepeefnflws

SCOPe Domain Coordinates for d2wwgb_:

Click to download the PDB-style file with coordinates for d2wwgb_.
(The format of our PDB-style files is described here.)

Timeline for d2wwgb_: