Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1hhja1: 1hhj A:182-275 [20704] Other proteins in same PDB: d1hhja2, d1hhjb_, d1hhjd2, d1hhje_ |
PDB Entry: 1hhj (more details), 2.5 Å
SCOP Domain Sequences for d1hhja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhja1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1hhja1:
View in 3D Domains from other chains: (mouse over for more information) d1hhjb_, d1hhjd1, d1hhjd2, d1hhje_ |