Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein) |
Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species) |
Species Escherichia coli [TaxId:562] [103015] (2 PDB entries) |
Domain d2ww4b2: 2ww4 B:164-282 [207039] Other proteins in same PDB: d2ww4a1, d2ww4b1 automated match to d1oj4a2 complexed with adp, gol |
PDB Entry: 2ww4 (more details), 2 Å
SCOPe Domain Sequences for d2ww4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ww4b2 d.58.26.5 (B:164-282) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]} dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhram
Timeline for d2ww4b2: