Lineage for d2ww4b1 (2ww4 B:1-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930509Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2930510Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89822] (2 species)
  7. 2930511Species Escherichia coli [TaxId:562] [102765] (2 PDB entries)
  8. 2930513Domain d2ww4b1: 2ww4 B:1-163 [207038]
    Other proteins in same PDB: d2ww4a2, d2ww4b2
    automated match to d1oj4a1
    complexed with adp, gol

Details for d2ww4b1

PDB Entry: 2ww4 (more details), 2 Å

PDB Description: a triclinic crystal form of E. coli 4-diphosphocytidyl-2C-methyl-D- erythritol kinase
PDB Compounds: (B:) 4-diphosphocytidyl-2c-methyl-d-erythritol kinase

SCOPe Domain Sequences for d2ww4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ww4b1 d.14.1.5 (B:1-163) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv
ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh
lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpv

SCOPe Domain Coordinates for d2ww4b1:

Click to download the PDB-style file with coordinates for d2ww4b1.
(The format of our PDB-style files is described here.)

Timeline for d2ww4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ww4b2