Lineage for d2ww4a2 (2ww4 A:164-283)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561426Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561474Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)
  6. 2561475Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)
  7. 2561476Species Escherichia coli [TaxId:562] [103015] (2 PDB entries)
  8. 2561479Domain d2ww4a2: 2ww4 A:164-283 [207037]
    Other proteins in same PDB: d2ww4a1, d2ww4b1
    automated match to d1oj4a2
    complexed with adp, gol

Details for d2ww4a2

PDB Entry: 2ww4 (more details), 2 Å

PDB Description: a triclinic crystal form of E. coli 4-diphosphocytidyl-2C-methyl-D- erythritol kinase
PDB Compounds: (A:) 4-diphosphocytidyl-2c-methyl-d-erythritol kinase

SCOPe Domain Sequences for d2ww4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ww4a2 d.58.26.5 (A:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd
avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml

SCOPe Domain Coordinates for d2ww4a2:

Click to download the PDB-style file with coordinates for d2ww4a2.
(The format of our PDB-style files is described here.)

Timeline for d2ww4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ww4a1