![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
![]() | Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89822] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102765] (2 PDB entries) |
![]() | Domain d2ww4a1: 2ww4 A:1-163 [207036] Other proteins in same PDB: d2ww4a2, d2ww4b2 automated match to d1oj4a1 complexed with adp, gol |
PDB Entry: 2ww4 (more details), 2 Å
SCOPe Domain Sequences for d2ww4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ww4a1 d.14.1.5 (A:1-163) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]} mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpv
Timeline for d2ww4a1: