SCOPe 2.07: Domain d2wubq1: 2wub Q:1-107

Lineage for d2wubq1 (2wub Q:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2wubq1: 2wub Q:1-107 [207028]
   Other proteins in same PDB: d2wubl2, d2wubq2
   automated match to d1rhha1

Details for d2wubq1

PDB Entry: 2wub, 2.9 Å

PDB Description: crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp

PDB Compounds: (Q:) fab fragment fab40.deltatrp light chain

SCOPe Domain Sequences for d2wubq1:

Sequence; same for both SEQRES and ATOM records:

>d2wubq1 b.1.1.0 (Q:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveik

Timeline for d2wubq1:

• d2wubq1 first appeared in SCOPe 2.03
  
• d2wubq1 appears in SCOPe 2.06
  
• d2wubq1 appears in the current release, SCOPe 2.08