Lineage for d2wuaa2 (2wua A:310-438)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917577Species Common sunflower (Helianthus annuus) [TaxId:4232] [225892] (1 PDB entry)
  8. 2917579Domain d2wuaa2: 2wua A:310-438 [207023]
    automated match to d1afwa2

Details for d2wuaa2

PDB Entry: 2wua (more details), 1.8 Å

PDB Description: structure of the peroxisomal 3-ketoacyl-coa thiolase from sunflower
PDB Compounds: (A:) acetoacetyl coa thiolase

SCOPe Domain Sequences for d2wuaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wuaa2 c.95.1.0 (A:310-438) automated matches {Common sunflower (Helianthus annuus) [TaxId: 4232]}
kglpilgvfrtfaavgvppsimgigpavaipaavkaaglqiddidlfeineafasqfvyc
qkkleidpqkinvnggamaighplgatgarcvatllhemkrrgrdcrfgvvsmcigtgmg
aaavfergd

SCOPe Domain Coordinates for d2wuaa2:

Click to download the PDB-style file with coordinates for d2wuaa2.
(The format of our PDB-style files is described here.)

Timeline for d2wuaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wuaa1