SCOPe 2.08: Domain d2wuaa1: 2wua A:47-309

Lineage for d2wuaa1 (2wua A:47-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Common sunflower (Helianthus annuus) [TaxId:4232] [225892] (1 PDB entry)

8. Domain d2wuaa1: 2wua A:47-309 [207022]
   automated match to d1afwa1

Details for d2wuaa1

PDB Entry: 2wua, 1.8 Å

PDB Description: structure of the peroxisomal 3-ketoacyl-coa thiolase from sunflower

PDB Compounds: (A:) acetoacetyl coa thiolase

SCOPe Domain Sequences for d2wuaa1:

Sequence; same for both SEQRES and ATOM records:

>d2wuaa1 c.95.1.0 (A:47-309) automated matches {Common sunflower (Helianthus annuus) [TaxId: 4232]}
gddvvivaayrsplckakrgglkdtypddilapvlkaliektninpaevgdivvgsvlga
gsqrasecrmaafyagfpetvpvrtvnrqcssglqavadvaaaikagfydigigaglesm
tanpmawegsvnpkvktmaqaqdcllpmgitsenvaqkfsitrqeqdqaavgshrktaaa
taagrfkdeiipiktkivdpktgdekpvtisvddgirpgtsladlaklkpvfrkdgstta
gtssqvsdgagavllmkrsialq

Timeline for d2wuaa1:

• d2wuaa1 first appeared in SCOPe 2.03
  
• d2wuaa1 appears in SCOPe 2.07