Lineage for d2ws2b2 (2ws2 B:78-204)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713997Species Haemonchus contortus [TaxId:6289] [226003] (1 PDB entry)
  8. 2713999Domain d2ws2b2: 2ws2 B:78-204 [207011]
    Other proteins in same PDB: d2ws2a1, d2ws2b1
    automated match to d1tw9a1

Details for d2ws2b2

PDB Entry: 2ws2 (more details), 2.01 Å

PDB Description: the 2 angstrom structure of a nu-class gst from haemonchus contortus
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2ws2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ws2b2 a.45.1.0 (B:78-204) automated matches {Haemonchus contortus [TaxId: 6289]}
agksaweeavvdsiadqfkdflnevrpyfkvllgmdqgdlkalekdvfeparqkfftivt
kilkenktgylvgdsltfadlyvaemgftehypklydgfpevkahaekvrsnpklkkwie
trpaskf

SCOPe Domain Coordinates for d2ws2b2:

Click to download the PDB-style file with coordinates for d2ws2b2.
(The format of our PDB-style files is described here.)

Timeline for d2ws2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ws2b1