SCOPe 2.08: Domain d2ws2b2: 2ws2 B:78-204

Lineage for d2ws2b2 (2ws2 B:78-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Haemonchus contortus [TaxId:6289] [226003] (1 PDB entry)

8. Domain d2ws2b2: 2ws2 B:78-204 [207011]
   Other proteins in same PDB: d2ws2a1, d2ws2b1
   automated match to d1tw9a1

Details for d2ws2b2

PDB Entry: 2ws2, 2.01 Å

PDB Description: the 2 angstrom structure of a nu-class gst from haemonchus contortus

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2ws2b2:

Sequence; same for both SEQRES and ATOM records:

>d2ws2b2 a.45.1.0 (B:78-204) automated matches {Haemonchus contortus [TaxId: 6289]}
agksaweeavvdsiadqfkdflnevrpyfkvllgmdqgdlkalekdvfeparqkfftivt
kilkenktgylvgdsltfadlyvaemgftehypklydgfpevkahaekvrsnpklkkwie
trpaskf

Timeline for d2ws2b2:

• d2ws2b2 first appeared in SCOPe 2.03
  
• d2ws2b2 appears in SCOPe 2.07