Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Haemonchus contortus [TaxId:6289] [226002] (1 PDB entry) |
Domain d2ws2b1: 2ws2 B:1-77 [207010] Other proteins in same PDB: d2ws2a2, d2ws2b2 automated match to d1tw9a2 |
PDB Entry: 2ws2 (more details), 2.01 Å
SCOPe Domain Sequences for d2ws2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ws2b1 c.47.1.0 (B:1-77) automated matches {Haemonchus contortus [TaxId: 6289]} mvhykltyfngrgaaeiirqvfvlagqdyedvrltheewpkhkasmpfgqlpvlevdgkq lpqsvaivrylarkfgy
Timeline for d2ws2b1: