SCOPe 2.05: Domain d2ws2b1: 2ws2 B:1-77

Lineage for d2ws2b1 (2ws2 B:1-77)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Haemonchus contortus [TaxId:6289] [226002] (1 PDB entry)

8. Domain d2ws2b1: 2ws2 B:1-77 [207010]
   Other proteins in same PDB: d2ws2a2, d2ws2b2
   automated match to d1tw9a2

Details for d2ws2b1

PDB Entry: 2ws2, 2.01 Å

PDB Description: the 2 angstrom structure of a nu-class gst from haemonchus contortus

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2ws2b1:

Sequence; same for both SEQRES and ATOM records:

>d2ws2b1 c.47.1.0 (B:1-77) automated matches {Haemonchus contortus [TaxId: 6289]}
mvhykltyfngrgaaeiirqvfvlagqdyedvrltheewpkhkasmpfgqlpvlevdgkq
lpqsvaivrylarkfgy

Timeline for d2ws2b1:

• d2ws2b1 first appeared in SCOPe 2.03
  
• d2ws2b1 appears in SCOPe 2.04
  
• d2ws2b1 appears in SCOPe 2.06
  
• d2ws2b1 appears in the current release, SCOPe 2.08