SCOP 1.73: Domain d1b0ga1: 1b0g A:182-275

Lineage for d1b0ga1 (1b0g A:182-275)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1b0ga1: 1b0g A:182-275 [20700]
   Other proteins in same PDB: d1b0ga2, d1b0gb_, d1b0gd2, d1b0ge_

Details for d1b0ga1

PDB Entry: 1b0g, 2.5 Å

PDB Description: class i histocompatibility antigen (hla-a2.1)/beta 2-microglobulin/peptide p1049 complex

PDB Compounds: (A:) class I histocompatibility antigen

SCOP Domain Sequences for d1b0ga1:

Sequence; same for both SEQRES and ATOM records:

>d1b0ga1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1b0ga1:

• d1b0ga1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0ga1 appears in SCOP 1.71
  
• d1b0ga1 appears in SCOP 1.75
  
• d1b0ga1 appears in the current release, SCOPe 2.08