SCOPe 2.08: Domain d2wrth1: 2wrt H:2-80

Lineage for d2wrth1 (2wrt H:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries)

8. Domain d2wrth1: 2wrt H:2-80 [206998]
   Other proteins in same PDB: d2wrta2, d2wrtb2, d2wrtc2, d2wrtd2, d2wrte2, d2wrtf2, d2wrtg2, d2wrth2, d2wrti2, d2wrtj2, d2wrtk2, d2wrtl2
   automated match to d1m9aa2
   complexed with cl

Details for d2wrth1

PDB Entry: 2wrt, 2.4 Å

PDB Description: the 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26

PDB Compounds: (H:) glutathione s-transferase class-mu 26 kda isozyme 51

SCOPe Domain Sequences for d2wrth1:

Sequence; same for both SEQRES and ATOM records:

>d2wrth1 c.47.1.0 (H:2-80) automated matches {Fasciola hepatica [TaxId: 6192]}
paklgywkirglqqpvrllleylgeeyeehlygrddrekwlgdkfnmgldlpnlpyyidd
kckltqsvaimryiadkhg

Timeline for d2wrth1:

• d2wrth1 first appeared in SCOPe 2.03
  
• d2wrth1 appears in SCOPe 2.07