Lineage for d2wrth1 (2wrt H:2-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879471Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries)
  8. 2879484Domain d2wrth1: 2wrt H:2-80 [206998]
    Other proteins in same PDB: d2wrta2, d2wrtb2, d2wrtc2, d2wrtd2, d2wrte2, d2wrtf2, d2wrtg2, d2wrth2, d2wrti2, d2wrtj2, d2wrtk2, d2wrtl2
    automated match to d1m9aa2
    complexed with cl

Details for d2wrth1

PDB Entry: 2wrt (more details), 2.4 Å

PDB Description: the 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
PDB Compounds: (H:) glutathione s-transferase class-mu 26 kda isozyme 51

SCOPe Domain Sequences for d2wrth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrth1 c.47.1.0 (H:2-80) automated matches {Fasciola hepatica [TaxId: 6192]}
paklgywkirglqqpvrllleylgeeyeehlygrddrekwlgdkfnmgldlpnlpyyidd
kckltqsvaimryiadkhg

SCOPe Domain Coordinates for d2wrth1:

Click to download the PDB-style file with coordinates for d2wrth1.
(The format of our PDB-style files is described here.)

Timeline for d2wrth1: