![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries) |
![]() | Domain d2wrtg2: 2wrt G:81-218 [206997] Other proteins in same PDB: d2wrta1, d2wrtb1, d2wrtc1, d2wrtd1, d2wrte1, d2wrtf1, d2wrtg1, d2wrth1, d2wrti1, d2wrtj1, d2wrtk1, d2wrtl1 automated match to d1bg5a1 complexed with cl |
PDB Entry: 2wrt (more details), 2.4 Å
SCOPe Domain Sequences for d2wrtg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrtg2 a.45.1.0 (G:81-218) automated matches {Fasciola hepatica [TaxId: 6192]} mlgstpeerarismiegaamdlrmgfvrvcynpkfeevkgdylkelpttlkmwsnflgdr hyltgssvshvdfmvyealdcirylapqcledfpklkefksriedlpkikaymesekfik wplnswiasfgggdaapa
Timeline for d2wrtg2: