Lineage for d2wrte2 (2wrt E:81-218)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713932Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries)
  8. 2713941Domain d2wrte2: 2wrt E:81-218 [206993]
    Other proteins in same PDB: d2wrta1, d2wrtb1, d2wrtc1, d2wrtd1, d2wrte1, d2wrtf1, d2wrtg1, d2wrth1, d2wrti1, d2wrtj1, d2wrtk1, d2wrtl1
    automated match to d1bg5a1
    complexed with cl

Details for d2wrte2

PDB Entry: 2wrt (more details), 2.4 Å

PDB Description: the 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
PDB Compounds: (E:) glutathione s-transferase class-mu 26 kda isozyme 51

SCOPe Domain Sequences for d2wrte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrte2 a.45.1.0 (E:81-218) automated matches {Fasciola hepatica [TaxId: 6192]}
mlgstpeerarismiegaamdlrmgfvrvcynpkfeevkgdylkelpttlkmwsnflgdr
hyltgssvshvdfmvyealdcirylapqcledfpklkefksriedlpkikaymesekfik
wplnswiasfgggdaapa

SCOPe Domain Coordinates for d2wrte2:

Click to download the PDB-style file with coordinates for d2wrte2.
(The format of our PDB-style files is described here.)

Timeline for d2wrte2: