SCOPe 2.03: Domain d2wrtb2: 2wrt B:81-218

Lineage for d2wrtb2 (2wrt B:81-218)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries)

8. Domain d2wrtb2: 2wrt B:81-218 [206987]
   Other proteins in same PDB: d2wrta1, d2wrtb1, d2wrtc1, d2wrtd1, d2wrte1, d2wrtf1, d2wrtg1, d2wrth1, d2wrti1, d2wrtj1, d2wrtk1, d2wrtl1
   automated match to d1bg5a1
   complexed with cl

Details for d2wrtb2

PDB Entry: 2wrt, 2.4 Å

PDB Description: the 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26

PDB Compounds: (B:) glutathione s-transferase class-mu 26 kda isozyme 51

SCOPe Domain Sequences for d2wrtb2:

Sequence; same for both SEQRES and ATOM records:

>d2wrtb2 a.45.1.0 (B:81-218) automated matches {Fasciola hepatica [TaxId: 6192]}
mlgstpeerarismiegaamdlrmgfvrvcynpkfeevkgdylkelpttlkmwsnflgdr
hyltgssvshvdfmvyealdcirylapqcledfpklkefksriedlpkikaymesekfik
wplnswiasfgggdaapa

Timeline for d2wrtb2:

• d2wrtb2 is new in SCOPe 2.03-stable
  
• d2wrtb2 appears in SCOPe 2.04
  
• d2wrtb2 appears in the current release, SCOPe 2.08