Lineage for d2wrcc1 (2wrc C:7-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2041090Species Unidentified influenza virus [TaxId:11309] [225763] (5 PDB entries)
  8. 2041102Domain d2wrcc1: 2wrc C:7-324 [206982]
    automated match to d1ha0a1

Details for d2wrcc1

PDB Entry: 2wrc (more details), 2.71 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrcc1 b.19.1.0 (C:7-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll
gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw
tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp
kyvkseklvlatglrnvp

SCOPe Domain Coordinates for d2wrcc1:

Click to download the PDB-style file with coordinates for d2wrcc1.
(The format of our PDB-style files is described here.)

Timeline for d2wrcc1: