Lineage for d2wrcb1 (2wrc B:5-324)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1306141Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1306142Protein automated matches [227017] (8 species)
    not a true protein
  7. 1306199Species Unidentified influenza virus [TaxId:11309] [225763] (4 PDB entries)
  8. 1306210Domain d2wrcb1: 2wrc B:5-324 [206981]
    automated match to d1ha0a1

Details for d2wrcb1

PDB Entry: 2wrc (more details), 2.71 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrcb1 b.19.1.0 (B:5-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d2wrcb1:

Click to download the PDB-style file with coordinates for d2wrcb1.
(The format of our PDB-style files is described here.)

Timeline for d2wrcb1: