![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries) |
![]() | Domain d1qrna1: 1qrn A:182-274 [20698] Other proteins in same PDB: d1qrna2, d1qrnd1, d1qrnd2, d1qrne1, d1qrne2 |
PDB Entry: 1qrn (more details), 2.8 Å
SCOP Domain Sequences for d1qrna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrna1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrw
Timeline for d1qrna1: