SCOP 1.57: Domain d1qrna1: 1qrn A:182-274

Lineage for d1qrna1 (1qrn A:182-274)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (24 PDB entries)

8. Domain d1qrna1: 1qrn A:182-274 [20698]
   Other proteins in same PDB: d1qrna2, d1qrnd1, d1qrnd2, d1qrne1, d1qrne2

Details for d1qrna1

PDB Entry: 1qrn, 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrna1:

Sequence; same for both SEQRES and ATOM records:

>d1qrna1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d1qrna1:

• d1qrna1 first appeared (with stable ids) in SCOP 1.55
  
• d1qrna1 appears in SCOP 1.59
  
• d1qrna1 appears in the current release, SCOPe 2.08