SCOPe 2.05: Domain d2wr7c1: 2wr7 C:7-324

Lineage for d2wr7c1 (2wr7 C:7-324)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus (a/singapore/1/1957(h2n2)) [TaxId:382781] [225764] (1 PDB entry)

8. Domain d2wr7c1: 2wr7 C:7-324 [206979]
   automated match to d1ha0a1

Details for d2wr7c1

PDB Entry: 2wr7, 2.5 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with human receptor

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wr7c1:

Sequence; same for both SEQRES and ATOM records:

>d2wr7c1 b.19.1.0 (C:7-324) automated matches {Influenza a virus (a/singapore/1/1957(h2n2)) [TaxId: 382781]}
icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll
gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw
tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp
kyvkseklvlatglrnvp

Timeline for d2wr7c1:

• d2wr7c1 first appeared in SCOPe 2.03
  
• d2wr7c1 appears in SCOPe 2.04
  
• d2wr7c1 appears in SCOPe 2.06
  
• d2wr7c1 appears in the current release, SCOPe 2.08