![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/singapore/1/1957(h2n2)) [TaxId:382781] [225764] (1 PDB entry) |
![]() | Domain d2wr7c1: 2wr7 C:7-324 [206979] automated match to d1ha0a1 |
PDB Entry: 2wr7 (more details), 2.5 Å
SCOPe Domain Sequences for d2wr7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wr7c1 b.19.1.0 (C:7-324) automated matches {Influenza A virus (a/singapore/1/1957(h2n2)) [TaxId: 382781]} icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp kyvkseklvlatglrnvp
Timeline for d2wr7c1: