Lineage for d2wr7b1 (2wr7 B:5-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2040950Species Influenza a virus (a/singapore/1/1957(h2n2)) [TaxId:382781] [225764] (1 PDB entry)
  8. 2040952Domain d2wr7b1: 2wr7 B:5-324 [206978]
    automated match to d1ha0a1

Details for d2wr7b1

PDB Entry: 2wr7 (more details), 2.5 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with human receptor
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wr7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wr7b1 b.19.1.0 (B:5-324) automated matches {Influenza a virus (a/singapore/1/1957(h2n2)) [TaxId: 382781]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d2wr7b1:

Click to download the PDB-style file with coordinates for d2wr7b1.
(The format of our PDB-style files is described here.)

Timeline for d2wr7b1: