Lineage for d2wr5b1 (2wr5 B:6-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2041090Species Unidentified influenza virus [TaxId:11309] [225763] (5 PDB entries)
  8. 2041098Domain d2wr5b1: 2wr5 B:6-324 [206975]
    automated match to d1ha0a1

Details for d2wr5b1

PDB Entry: 2wr5 (more details), 2.65 Å

PDB Description: structure of influenza h2 duck ontario hemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wr5b1:

Sequence, based on SEQRES records: (download)

>d2wr5b1 b.19.1.0 (B:6-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
lgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhlltsvthfekikilprdq
wtqhtttggsracavsgnpsffrnmvwltkkgsnypvakrsynntsgeqmliiwgihypn
ddteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfe
stgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigec
pkyvksdrlvlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d2wr5b1 b.19.1.0 (B:6-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
lgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhlltsvthfekikilprdq
wtqhtttggsracavgnpsffrnmvwltkkgsnypvakrsynntsgeqmliiwgihypnd
dteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
kyvksdrlvlatglrnvp

SCOPe Domain Coordinates for d2wr5b1:

Click to download the PDB-style file with coordinates for d2wr5b1.
(The format of our PDB-style files is described here.)

Timeline for d2wr5b1: