SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wr1c1 (2wr1 C:6-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (27 species)
    not a true protein
  7. 2041090Species Unidentified influenza virus [TaxId:11309] [225763] (5 PDB entries)
  8. 2041093Domain d2wr1c1: 2wr1 C:6-324 [206973]
    automated match to d1ha0a1
    complexed with nag

Details for d2wr1c1

PDB Entry: 2wr1 (more details), 2.1 Å

PDB Description: structure of influenza h2 hemagglutinin with human receptor
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wr1c1:

Sequence, based on SEQRES records: (download)

>d2wr1c1 b.19.1.0 (C:6-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprdq
wtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhpn
ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfe
stgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigec
pkyvksdrlvlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d2wr1c1 b.19.1.0 (C:6-324) automated matches {Unidentified influenza virus [TaxId: 11309]}
qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprdq
wtqhtttggsracavldnpsffrnmvltkkgsnypiakrsynntsgeqmliiwgihhpnd
daeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
kyvksdrlvlatglrnvp

SCOPe Domain Coordinates for d2wr1c1:

Click to download the PDB-style file with coordinates for d2wr1c1.
(The format of our PDB-style files is described here.)

Timeline for d2wr1c1: