![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries) |
![]() | Domain d2wr1b1: 2wr1 B:5-326 [206972] automated match to d1ha0a1 complexed with nag |
PDB Entry: 2wr1 (more details), 2.1 Å
SCOPe Domain Sequences for d2wr1b1:
Sequence, based on SEQRES records: (download)
>d2wr1b1 b.19.1.0 (B:5-326) automated matches {Unidentified influenza virus [TaxId: 11309]} dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd qwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhp nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinf estgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltige cpkyvksdrlvlatglrnvpqi
>d2wr1b1 b.19.1.0 (B:5-326) automated matches {Unidentified influenza virus [TaxId: 11309]} dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd qwtqhtttggsracavldnpsffrnmvltkkgsnypiakrsynntsgeqmliiwgihhpn ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfe stgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigec pkyvksdrlvlatglrnvpqi
Timeline for d2wr1b1: