SCOPe 2.04: Domain d2wr0a1: 2wr0 A:5-325

Lineage for d2wr0a1 (2wr0 A:5-325)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:11309] [225763] (4 PDB entries)

8. Domain d2wr0a1: 2wr0 A:5-325 [206968]
   automated match to d1ha0a1
   complexed with nag

Details for d2wr0a1

PDB Entry: 2wr0, 2.45 Å

PDB Description: structures of influenza h2 hemagglutinins

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2wr0a1:

Sequence; same for both SEQRES and ATOM records:

>d2wr0a1 b.19.1.0 (A:5-325) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw
llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd
qwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhp
nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinf
estgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltige
cpkyvksdrlvlatglrnvpq

Timeline for d2wr0a1:

• d2wr0a1 first appeared in SCOPe 2.03
  
• d2wr0a1 appears in SCOPe 2.05
  
• d2wr0a1 appears in the current release, SCOPe 2.08