Class b: All beta proteins [48724] (174 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (8 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [225763] (4 PDB entries) |
Domain d2wr0a1: 2wr0 A:5-325 [206968] automated match to d1ha0a1 complexed with nag |
PDB Entry: 2wr0 (more details), 2.45 Å
SCOPe Domain Sequences for d2wr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wr0a1 b.19.1.0 (A:5-325) automated matches {Unidentified influenza virus [TaxId: 11309]} dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd qwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhp nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinf estgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltige cpkyvksdrlvlatglrnvpq
Timeline for d2wr0a1: