SCOPe 2.03: Domain d2wqwb2: 2wqw B:241-321

Lineage for d2wqwb2 (2wqw B:241-321)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (22 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)

8. Domain d2wqwb2: 2wqw B:241-321 [206963]
   Other proteins in same PDB: d2wqwa1, d2wqwb1
   automated match to d1m9sa1
   complexed with peg

Details for d2wqwb2

PDB Entry: 2wqw, 2.24 Å

PDB Description: double-disulfide cross-linked crystal dimer of the listeria monocytogenes inlb internalin domain

PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d2wqwb2:

Sequence; same for both SEQRES and ATOM records:

>d2wqwb2 b.1.18.0 (B:241-321) automated matches {Listeria monocytogenes [TaxId: 169963]}
ealnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplke

Timeline for d2wqwb2:

• d2wqwb2 is new in SCOPe 2.03-stable
  
• d2wqwb2 appears in SCOPe 2.04
  
• d2wqwb2 appears in the current release, SCOPe 2.08