![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries) |
![]() | Domain d2wqwb2: 2wqw B:241-321 [206963] Other proteins in same PDB: d2wqwa1, d2wqwb1 automated match to d1m9sa1 complexed with peg |
PDB Entry: 2wqw (more details), 2.24 Å
SCOPe Domain Sequences for d2wqwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqwb2 b.1.18.0 (B:241-321) automated matches {Listeria monocytogenes [TaxId: 169963]} ealnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq pvtigkakarfhgrvtqplke
Timeline for d2wqwb2: