Lineage for d2wqwa2 (2wqw A:241-321)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771214Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1771219Domain d2wqwa2: 2wqw A:241-321 [206961]
    Other proteins in same PDB: d2wqwa1, d2wqwb1
    automated match to d1m9sa1
    complexed with peg

Details for d2wqwa2

PDB Entry: 2wqw (more details), 2.24 Å

PDB Description: double-disulfide cross-linked crystal dimer of the listeria monocytogenes inlb internalin domain
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d2wqwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqwa2 b.1.18.0 (A:241-321) automated matches {Listeria monocytogenes [TaxId: 169963]}
ealnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplke

SCOPe Domain Coordinates for d2wqwa2:

Click to download the PDB-style file with coordinates for d2wqwa2.
(The format of our PDB-style files is described here.)

Timeline for d2wqwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wqwa1