| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
| Protein automated matches [226952] (2 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [225326] (6 PDB entries) |
| Domain d2wqwa1: 2wqw A:36-240 [206960] Other proteins in same PDB: d2wqwa2, d2wqwb2 automated match to d1m9sa5 complexed with peg |
PDB Entry: 2wqw (more details), 2.24 Å
SCOPe Domain Sequences for d2wqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqwa1 c.10.2.1 (A:36-240) automated matches {Listeria monocytogenes [TaxId: 169963]}
etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplacltklqnlyl
sknhisdlralcglknldvlelfsq
Timeline for d2wqwa1: