SCOP 1.59: Domain d1ao7a1: 1ao7 A:182-274

Lineage for d1ao7a1 (1ao7 A:182-274)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries)

8. Domain d1ao7a1: 1ao7 A:182-274 [20696]
   Other proteins in same PDB: d1ao7a2, d1ao7d_, d1ao7e1, d1ao7e2

Details for d1ao7a1

PDB Entry: 1ao7, 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ao7a1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d1ao7a1:

• d1ao7a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ao7a1 appears in SCOP 1.57
  
• d1ao7a1 appears in SCOP 1.61
  
• d1ao7a1 appears in the current release, SCOPe 2.08