| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (43 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries) |
| Domain d2wqva2: 2wqv A:241-320 [206957] Other proteins in same PDB: d2wqva1, d2wqvb1 automated match to d1m9sa1 complexed with pg4, pge |
PDB Entry: 2wqv (more details), 2.8 Å
SCOPe Domain Sequences for d2wqva2:
Sequence, based on SEQRES records: (download)
>d2wqva2 b.1.18.0 (A:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk
>d2wqva2 b.1.18.0 (A:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlnevsfifyqpvti
gkakarfhgrvtqplk
Timeline for d2wqva2: