Lineage for d2wqva2 (2wqv A:241-320)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771214Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1771227Domain d2wqva2: 2wqv A:241-320 [206957]
    Other proteins in same PDB: d2wqva1, d2wqvb1
    automated match to d1m9sa1
    complexed with pg4, pge

Details for d2wqva2

PDB Entry: 2wqv (more details), 2.8 Å

PDB Description: internalin domain of listeria monocytogenes inlb: rhombohedral crystal form
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d2wqva2:

Sequence, based on SEQRES records: (download)

>d2wqva2 b.1.18.0 (A:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk

Sequence, based on observed residues (ATOM records): (download)

>d2wqva2 b.1.18.0 (A:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlnevsfifyqpvti
gkakarfhgrvtqplk

SCOPe Domain Coordinates for d2wqva2:

Click to download the PDB-style file with coordinates for d2wqva2.
(The format of our PDB-style files is described here.)

Timeline for d2wqva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wqva1