![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (22 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries) |
![]() | Domain d2wque2: 2wqu E:241-320 [206953] Other proteins in same PDB: d2wqua1, d2wqub1, d2wquc1, d2wqud1, d2wque1, d2wquf1 automated match to d1m9sa1 complexed with gol, so4 |
PDB Entry: 2wqu (more details), 2.6 Å
SCOPe Domain Sequences for d2wque2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wque2 b.1.18.0 (E:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]} eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq pvtigkakarfhgrvtqplk
Timeline for d2wque2: