| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
| Protein automated matches [226952] (1 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [225326] (5 PDB entries) |
| Domain d2wque1: 2wqu E:37-240 [206952] Other proteins in same PDB: d2wqua2, d2wqub2, d2wquc2, d2wqud2, d2wque2, d2wquf2 automated match to d1m9sa5 complexed with gol, so4 |
PDB Entry: 2wqu (more details), 2.6 Å
SCOPe Domain Sequences for d2wque1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wque1 c.10.2.1 (E:37-240) automated matches {Listeria monocytogenes [TaxId: 169963]}
titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
knhisdlralaglknldvlelfsq
Timeline for d2wque1: