Lineage for d2wqud2 (2wqu D:241-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766372Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries)
  8. 2766383Domain d2wqud2: 2wqu D:241-321 [206951]
    Other proteins in same PDB: d2wqua1, d2wqub1, d2wquc1, d2wqud1, d2wque1, d2wquf1
    automated match to d1m9sa1
    complexed with gol, so4

Details for d2wqud2

PDB Entry: 2wqu (more details), 2.6 Å

PDB Description: internalin domain of listeria monocytogenes inlb: triclinic crystal form
PDB Compounds: (D:) internalin b

SCOPe Domain Sequences for d2wqud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqud2 b.1.18.0 (D:241-321) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplke

SCOPe Domain Coordinates for d2wqud2:

Click to download the PDB-style file with coordinates for d2wqud2.
(The format of our PDB-style files is described here.)

Timeline for d2wqud2: